Real Zepbound® (tirzepatide)
Patient Stories
Stories
Watch real zepbound patient stories
Stories
Share your story
Share your story with us about life on Zepbound
ShareYourStory
00:00-00:02
[Close-up view of the upper section of a Ferris wheel against a clear blue sky. The image shows several gondolas in red and blue attached to the wheel’s white metal spokes. The focus is slightly soft, making the image a bit blurry. The sound of people screaming and having fun fills the background.]
CAPTION: Please see the safety information before Heather’s story.
00:02-00:46
[The Zepbound logo and dosing information appears at the top left of the screen. A timer appears on the top right of the screen, counting down the time till Heather’s video starts. The Zepbound indications appear on the screen and stay there till the narrator concludes. The Ferris wheel continues rotating in the background.]
CAPTION: Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Hear Heather’s story in 01:24
Zepbound is an injectable prescription medicine that may help adults with obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off. It may also help adults with moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA. It should be used with a reduced-calorie diet and increased physical activity.
• Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines.
• It is not known if Zepbound is safe and effective for use in children.
00:46-01:29
[The Zepbound indication on screen is replaced with the Select Safety Information. The countdown timer continues counting down till the start of the video. The Ferris wheel continues to rotate in the background.]
CAPTION: Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Hear Heather’s story in 00:41
Select Safety Information
Warning:
Tell your healthcare provider if you get a lump or swelling in your neck, hoarseness, trouble swallowing, or shortness of breath. These may be symptoms of thyroid cancer. In studies with rats, Zepbound and medicines that work like Zepbound caused thyroid tumors, including thyroid cancer. It is not known if Zepbound will cause thyroid tumors, or a type of thyroid cancer called medullary thyroid carcinoma (MTC) in people. Do not take Zepbound if you or any of your family have ever had MTC or if you have an endocrine system condition called Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
See Indications and Safety Summary with Warnings at the end of this video.
01:29-01:31
[Aerial view of an amusement park with a large Ferris wheel in the foreground. Surrounding the Ferris wheel are green trees and paved walkways. In the background, there are roller coasters with looping tracks, a carousel, and several colorful buildings.]
CAPTION: Heather is a Zepbound patient and was compensated for her time. Individual results may vary. Talk to your doctor to see if Zepbound is right for you.
01:31-01:34
[Heather is walking outdoors with her daughter and her eldest son in a sunny area. The scene changes to show Heather speaking to the camera.]
HEATHER: Being in the park here today means the world.
01:34-01:39
[Heather and her daughter are seated inside a Ferris wheel gondola. The scene changes briefly to show Heather speaking to the camera and then again reverts back to inside the Ferris wheel.]
HEATHER: I've been wanting to take my kids to an amusement park for as long as I can remember.
01:39-01:42
[Heather is seated on a Ferris wheel gondola with her daughter and her oldest son. They are sitting close together. The scene changes to a close-up, black-and-white shot of showing Heather walking on a paved sidewalk.]
HEATHER: I had a lot of things holding me back.
01:42-01:56
[The video continues in black-and-white. Heather is outdoors in a sunny area, raising her hand to shield her eyes from the bright light. The scene changes to show a large swing ride rotating with an empty wooden bench in the foreground. The scene changes again to show the interior of an empty roller coaster car entering a loading station. Two amusement park staff members start prepping the ride vehicle.]
HEATHER: I was concerned I couldn't handle the heat. I didn't want to draw attention to myself when I'd have to continue to stop. I worried I wouldn't fit in the seats. I wouldn't be able to secure the belts and the safety devices.
01:56-02:06
[Heather and her eldest son are sitting together on a porch swing, smiling at each other. The scene changes briefly to a shot of a large swing ride rotating at an amusement park in black-and-white. Heather speaks to the camera, sitting indoors in a well-lit room.
HEATHER: Michael, my oldest, went to an amusement park for the first time without me. He went on that rollercoaster. That was sad for me.
02:06-02:13
[A very close-up shot of Heather indoors. A close-up of the projector leads to a shot of Heather sitting in a dimly lit room, facing a wall where a photo is projected. The photo shows Heather outdoors in a formal dark dress, holding a bouquet of flowers, with green grass and trees in the background. The scene changes to show an older photo of Heather taken indoors wearing a maroon hoodie.]
HEATHER: I've been trying to lose weight on and off all my life, but really in the last 10 years has been very challenging.
02:13-02:23
[Heather looks at older photos projected on the wall, including a photo with her two young children, a black-and-white childhood photograph, and another slightly older photograph. Scene changes to show Heather sitting on a dark-colored couch in a dimly lit room.]
HEATHER: My daughter's never known me, not overweight. When I was a kid, I was always the chunkier one. I'd get made fun of.
02:23-02:33
[Heather is walking barefoot along the edge of an indoor swimming pool. The scene changes to show Heather standing beside an indoor swimming pool, facing the water. She slowly turns around to face the camera.]
HEATHER: Pools were not my friend either. We'd like swim underwater and everybody would have their legs spread and you'd swim through 'em like a tunnel. Oh, when it came to my turn, they'd usually swim away.
02:33-02:39
[Heather speaks to the camera. The scene changes to close-ups of Heather’s face indoors. Her eyes have a tinge of red as she holds back tears.]
HEATHER: My weight loss journey has been a roller coaster. I had tried different diets and exercise and nothing was working.
02:39-02:48
[Heather is standing in a modern kitchen, facing the sink and washing dishes. The scene changes to show a few quick shots of her closing the oven door, opening the fridge, opening a packet of snacks, and taking a plate out of the cabinet. Montage ends to show Heather sitting on a dark-colored couch in a cozy living room. The camera angle tilts as she gets off the couch.]
HEATHER: My relationship with food was very loud. Even when I wasn't hungry.
02:48-03:03
[Aerial view of a suburban neighborhood on a sunny day with rows of houses with sloped roofs, surrounded by lush green trees and intersecting streets. The scene changes to show Heather doing some light gardening outdoors, surrounded by trees and plants. Heather speaking to the camera cuts in between her gardening scene.]
HEATHER: I advocated for myself and I was able to assemble a team that heard me and was willing to advocate for changes that I was needing to make. My doctors put in a recommendation for Zepbound for me.
CAPTION: Individual results may vary. Talk to your doctor to see if Zepbound® is right for you.
03:03-03:06
[Heather walks alongside her daughter riding a bicycle down a stone pathway in front of a wooden house with a porch, surrounded by lush greenery and hanging plants. The scene changes to a close-up of Heather walking as the sun falls on her face.]
HEATHER: I am so happy that they recommended Zepbound.
CAPTION: Individual results may vary. Talk to your doctor to see if Zepbound® is right for you.
03:06-03:11
[Heather chases after her daughter as she speeds up on her bicycle. Scene changes to show Heather speaking to the camera.]
HEATHER: With Zepbound along with diet and exercise, I'm losing weight and keeping it off.
CAPTION: Throughout a 17-month clinical trial, people who dieted, exercised,* and took Zepbound sustained weight loss-whether taking the 5-mg, 10-mg, or 15-mg dose.†
Zepbound is not for cosmetic weight loss.
*Along with a reduced-calorie diet and increased physical activity. †Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 Ibs) on 5 mg, ~13-20% (28-44 Ibs) on 10 mg, and ~15-21% (33-48 Ibs) on 15 mg compared to ~3% (7 Ibs) on placebo. Avg. baseline weights were ~220-233 Ibs.
03:11-03:27
[Heather is walking briskly across a sunny patio carrying a tray. Behind her, her son throws a frisbee to her daughter on the grass near outdoor furniture. A long dining table and a grill are in the foreground. Heather cooks and seasons corn, zucchini, and sliced peppers and steak on the grill. Scene changes to show Heather speaking to the camera.]
HEATHER: Grilling is one of my favorite ways to cook supper. Desire for food all the time pretty much stopped after Zepbound. I've gone down several sizes and I've been able to clean out my closet and donate the clothes that don't fit me anymore.
CAPTION: Zepbound is not for cosmetic weight loss.
*Along with a reduced-calorie diet and increased physical activity. †Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 Ibs) on 5 mg, ~13-20% (28-44 Ibs) on 10 mg, and ~15-21% (33-48 Ibs) on 15 mg compared to ~3% (7 Ibs) on placebo. Avg. baseline weights were ~220-233 Ibs.
03:27-03:39
[A quick shot of Heather opening the grill. Scenes play showing her spending time with her children outdoors and playing with her daughter in an indoor swimming pool. Scene changes to close in on Heather’s face outdoors surrounded by trees and greenery.]
HEATHER: I'm gonna dust off the bike and ride with my daughter. I'm gonna play catch with my son. We're gonna do the activities that they want to do while they still want to do them with me.
03:39-03:50
[A wide aerial shot of an amusement park with colorful rides. A large Ferris wheel, roller coasters, tall drop towers, and other attractions operate in the background. Scene changes to Heather speaking to the camera. Scene changes to Heather walking around the amusement park with her daughter and son.]
HEATHER: I've always had a dream to take my kids to the amusement park, but we are here today and it's amazing.
03:50-03:58
[Heather stands facing a large swing ride. Scene changes to Heather walking hand in hand with her son and daughter toward the entrance of an amusement park ride and speaking to each other.]
HEATHER: This is an important summer for me. My oldest is gonna be a senior and moving on soon, so having these memories with him now, it means the world.
03:58-04:05
[Heather and her daughter are seated side by side in a roller coaster.]
HEATHER: Like a glove.
HEATHER’S DAUGHTER: Yeah.
04:05-04:12
[Heather and her daughter are riding a roller coaster with their arms raised high in the air.]
HEATHER: In the past, my weight loss journey has been a roller coaster. It's been frustrating. It's been bumpy.
04:12-04:17
[Heather and her daughter are riding a carousel. Scene changes to Heather seated on a Ferris wheel with her son and daughter. They are sharing a gondola.]
HEATHER: With Zepbound, I got off that rollercoaster.
CAPTION: *Along with diet and exercise. Individual results may vary.
04:17-04:23
[Heather is walking outdoors with her son and daughter. Her children run off and she turns to look at the camera and smiles.]
HEATHER: This is just the beginning of my journey. I'm bound from making memories with my family.
CAPTION: boundforTM
04:23-04:27
[Zepbound end card appears on screen, including the Zepbound logo, dosing information, and trademark information.]
CAPTION: Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
visit Zepbound.com
or call 1-800-LillyRx
CMAT-19959 04/2026 © Lilly USA, LLC. 2026. All rights reserved.
Zepbound®, its delivery device base and KwikPen® are registered trademarks and Boundfor™ is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
04:27-04:30
[Animated Lilly Medicine logo appears on red screen.]
CAPTION: Lilly
A MEDICINE COMPANY
04:30-05:56
[Outro to white before indications and safety summary with warnings appear on the screen and begins to scroll automatically after a short pause. The Zepbound logo and dosing information remain locked at the top right of the screen.]
CAPTION: INDICATIONS AND SAFETY SUMMARY WITH WARNINGS
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Zepbound® (ZEHP-bownd) is an injectable prescription medicine used with a reduced-calorie diet and increased physical activity to help adults with:
- obesity, or some adults with overweight who also have weight-related medical problems to lose excess body weight and keep the weight off.
- moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA.
Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
Warnings - Zepbound may cause tumors in the thyroid, including thyroid cancer. Watch for possible symptoms, such as a lump or swelling in the neck, hoarseness, trouble swallowing, or shortness of breath. If you have any of these symptoms, tell your healthcare provider.
- Do not use Zepbound if you or any of your family have ever had a type of thyroid cancer called medullary thyroid carcinoma (MTC).
- Do not use Zepbound if you have Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
- Do not use Zepbound if you have had a serious allergic reaction to tirzepatide or any of the ingredients in Zepbound.
KwikPen® : Do not share your KwikPen with other people, even if the pen needle has been changed. You may give other people a serious infection or get a serious infection from them.
05:56-08:22
[Safety Summary continues scrolling automatically in tandem with the narrator.]
CAPTION: Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Zepbound may cause serious side effects, including:
Severe stomach problems. Stomachproblems,sometimessevere,havebeenreportedinpeoplewhouseZepbound.Tellyourhealthcareproviderifyouhavestomachproblemsthataresevereorwillnotgoaway.
Dehydration leading to kidney problems. Diarrhea,nausea,andvomitingmaycausealossoffluids (dehydration),whichmaycausekidneyproblems.Itisimportantforyoutodrinkfluidstohelpreduceyourchanceofdehydration. Tell your healthcare provider right away if you have nausea, vomiting, or diarrhea that does not go away.
Gallbladder problems. GallbladderproblemshavehappenedinsomepeoplewhouseZepbound.Tellyourhealthcareproviderrightawayifyougetsymptomsofgallbladderproblems,whichmayincludepaininyourupperstomach (abdomen),fever,yellowingofskinoreyes (jaundice),orclay - coloredstools.
Inflammation of the pancreas (pancreatitis). StopusingZepboundandcallyourhealthcareproviderrightaway.Ifyouhaveseverepaininyourstomacharea (abdomen) thatwillnotgoaway,withorwithoutvomiting.Youmayfeelthepainfromyourabdomentoyourback.
Serious allergic reactions. StopusingZepboundandgetmedicalhelprightawayifyouhaveanysymptomsofaseriousallergicreaction,includingswellingofyourface,lips,tongueorthroatproblemsbreathingorswallowing,severerashoritching,faintingorfeelingdizzy,orveryrapidheartbeat.
Low blood sugar (hypoglycemia). YourriskforgettinglowbloodsugarmaybehigherifyouuseZepboundwithmedicinesthatcancauselowbloodsugar,suchasasulfonylureaorinsulin.Signs and symptoms of low blood sugarmayincludedizzinessorlight - headedness,sweating,confusionordrowsiness,headache,blurredvision,slurredspeech,shakiness,fastheartbeat,anxiety,irritability,moodchanges,hunger,weaknessorfeelingjittery.
Changes in vision in patients with type 2 diabetes. TellyourhealthcareproviderifyouhavechangesinvisionduringtreatmentwithZepbound.
Food or liquid getting into the lungs during surgery or other procedures that use anesthesia or deep sleepiness (deep sedation). Zepboundmayincreasethechanceoffoodgettingintoyourlungsduringsurgeryorotherprocedures.TellallyourhealthcareprovidersthatyouaretakingZepboundbeforeyouarescheduledtohavesurgeryorotherprocedures.
08:22-08:59
[Safety Summary continues scrolling in tandem with the narrator.]
CAPTION: Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Common side effects
ThemostcommonsideeffectsofZepboundincludenausea,diarrhea,vomiting,constipation,stomach (abdominal) pain,indigestion,injectionsitereactions,feelingtired,allergicreactions,belching,hairloss,andheartburn.ThesearenotallthepossiblesideeffectsofZepbound.Talktoyourhealthcareprovideraboutanysideeffectthatbothersyouordoesn'tgoaway.
Tellyourdoctorifyouhaveanysideeffects.You can report sideeffects at 1-800-FDA-1088 or*www.fda.gov/medwatch*.
08:59-12:50
[Safety Summary continues scrolling in tandem with the narrator.]
CAPTION: Before using Zepbound
• Your healthcare provider should show you how to use Zepbound before you use it for the first time.
• Talk to your healthcare provider about low blood sugar and how to manage it. Tell your
healthcare provider if you are taking medicines to treat diabetes including an insulin or
sulfonylurea.
• If you take birth control pills by mouth, talk to your healthcare provider before you use
Zepbound. Birth control pills may not work as well while using Zepbound. Your healthcare
provider may recommend another type of birth control for 4 weeks after you start Zepbound
and for 4 weeks after each increase in your dose of Zepbound.
Review these questions with your healthcare provider:
❑ Do you have other medical conditions, including problems with your pancreas, or severe problems with your stomach, such as slowed emptying of your stomach (gastroparesis) or problems digesting food?
❑ Do you take diabetes medicines, such as insulin or sulfonylureas?
❑ Do you have a history of diabetic retinopathy?
❑ Are you scheduled to have surgery or other procedures that use anesthesia or deep sleepiness (deep sedation)?
❑ Do you take any other prescription medicines or over-the-counter drugs, vitamins, or herbal supplements?
❑ Are you pregnant, plan to become pregnant, breastfeeding, or plan to breastfeed? Zepbound may harm your unborn baby. Tell your healthcare provider if you become pregnant while using Zepbound. Zepbound may pass into your breast milk. You should talk with your healthcare provider about the best way to feed your baby while using Zepbound.
• Pregnancy Exposure Registry: There will be a pregnancy exposure registry for women who have taken Zepbound during pregnancy. The purpose of this registry is to collect information about the health of you and your baby. Talk to your healthcare provider about how you can take part in this registry, or you may contact Lilly at 1-800-LillyRx (1-800-545-5979).
How to take
- Read the Instructions for Use that come with Zepbound.
- Use Zepbound exactly as your healthcare provider says.
- Use Zepbound with a reduced-calorie diet and increased physical activity.
- Inject Zepbound under the skin (subcutaneously) of your stomach (abdomen), thigh, or
have another person inject in the back of the upper arm. Do not inject ZEPBOUND into a
muscle (intramuscularly) or vein (intravenously).
- Use Zepbound 1 time each week, at any time of the day.
- Change (rotate) your injection site with each weekly injection. Do not use the same site for each injection.
If you take too much Zepbound, call your healthcare provider, call the Poison Help line at 1-800-222-1222 or go to the nearest hospital emergency room right away.
Zepbound is approved as a 2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, and 15 mg injection.
Learn more
Zepbound is a prescription medicine. For more information, call 1-800-LillyRx (1-800-545-5979) [or go towww.zepbound.lilly.com].
This summary provides basic information about Zepbound but does not include all information known about this medicine. Read the information that comes with your prescription each time your prescription is filled. This information does not take the place of talking with your healthcare provider. Be sure to talk to your healthcare provider about Zepbound and how to take it. Your healthcare provider is the best person to help you decide if Zepbound is right for you.
ZP CON BS 25FEB2026
Zepbound®, its delivery device base and KwikPen® are registered trademarks owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
Voice over generated by AI.
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
12:50-12:53
[Zepbound end card appears on screen, including the Zepbound logo, dosing information, and trademark information.]
CAPTION: Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
visit Zepbound.com
or call 1-800-LillyRx
CMAT-19959 04/2026 © Lilly USA, LLC. 2026. All rights reserved.
Zepbound® , its delivery device base and KwikPen® are registered trademarks and Boundfor™ is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
12:53-12:56
[Animated Lilly Medicine logo appears on screen in white text on a red background.]
CAPTION: Lilly
A MEDICINE COMPANY
Heather
00:00-00:04
[Animated intro sequence appears.]
CAPTION: Please see the safety information before Tim Bo's story.
00:04-00:43
[Opening indications appear and remain on-screen until the narrator concludes. A timer appears on the top right of the screen, counting down the time till Tim Bo’s video starts.]
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Hear Tim Bo’s story in 00:01:11
Zepbound is an injectable prescription medicine that may help adults with obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off. It may also help adults with moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA. It should be used with a reduced-calorie diet and increased physical activity.
- Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines.
- It is not known if Zepbound is safe and effective for use in children.
00:43-1:24
[Select safety information appears on the screen.]
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Hear Tim Bo’s story in 00:00:37
Select Safety Information
Warning:
Tell your healthcare provider if you get a lump or swelling in your neck, hoarseness, trouble swallowing, or shortness of breath. These may be symptoms of thyroid cancer. In studies with rats, Zepbound and medicines that work like Zepbound caused thyroid tumors, including thyroid cancer. It is not known if Zepbound will cause thyroid tumors, or a type of thyroid cancer called Medullary Thyroid Carcinoma (MTC) in people. Do not take Zepbound if you or any of your family have ever had MTC or if you have an endocrine system condition called multiple endocrine neoplasia syndrome type 2 (MEN 2).
See Indications and Safety Summary with Warnings at the end of this video.
1:24-1:36
[Tim Bo hits the alarm clock; video pans to Tim Bo sipping his morning coffee.]
CAPTION: Tim Bo is a Zepbound patient and was compensated for his time. Individual results may vary. Talk to your doctor to see if Zepboundis right for you.
TIM BO: When I get up at 5:00 am, that is Tim Bo time... That's me time. It gives me an opportunity to pour into myself. It's my solitude time.
1:36-1:44
[Tim Bo in his salon speaking to camera; video pans to Tim Bo putting on his shoes.]
TIM BO: I love to start the day with a good cup of coffee. From there, I grab my workout partner, my dog, Princess.
1:44-1:49
[Tim Bo’s dog princess runs up to greet Tim Bo as he finishes tying his shoes. They leash up and walk toward the door.]
TIM BO: She actually holds me accountable. I can look over and the first thing that she’s gonna do is she’s like...”
1:49-2:00
[Tim Bo in his salon speaking to camera; video pans to Tim Bo jogging with Princess in the neighborhood.]
TIM BO: ‘We’re ready to go?’ We’re ready to go. And we’re out there hitting the neighborhood.
2:00-2:06
[Overhead shot of high school football field; video pans to eye-level view of track; Tim Bo jogging on the track.]
TIM BO: To be able to run and to be able to move has always been a superpower for me. In high school, I ran track...
2:06-2:09
[Tim Bo shrugging in front of the camera.]
TIM BO: ...and I was at the top of my game. And then...
2:09-2:13
[Tim Bo in his salon speaking to the camera.]
TIM BO: ...I turned 18...and then (laughs)
2:13-2:19
[Tim Bo walking on the track; video pans to Tim Bo standing on the track in front of bleachers.]
TIM BO: When I went off to college, I didn’t keep up with my running. They talk about the freshman 15...
2:19-2:21
[Tim Bo in his salon speaking to camera.]
TIM BO: I put on the freshman 30.
2:21-2:25
[Tim Bo looking out onto the track; Tim Bo runs over the camera as it transitions to next scene.]
TIM BO: And over the years, I definitely started to feel it.
2:25-2:35
[Tim Bo watching old photos on the projector.]
TIM BO: Life happened, and I got married. Had my beautiful baby girl. And all that time, I just kept putting on weight. I noticed that my blood pressure kept getting higher.
2:35-2:41
[Tim Bo continues watching old photos from his past on a projector.]
TIM BO: With my clothes, I was always having to go a size up. What really got me was...
2:41-2:48
[Video pans from Tim Bo’s shoes up to him working with a client in his salon; video pans to Tim Bo in his salon looking at an old picture in the mirror and reflecting]
TIM BO: I’m a stylist and I do fashion shows. And I saw a picture of me that caught me from the side. It showed me how much weight...
2:48-2:59
[Tim Bo walks out on to the football field/track; shots of Tim Bo on the track.]
TIM BO: ...I actually put on. I remember I couldn’t breathe I was so out of breath. I remember being a little bit on the dizzy side because I was so exhausted. That photo hurt.
2:59-3:08
[Tim Bo in his salon; video pans to him looking out on the track; close up of Tim Bo reflecting; pans to aerial of Tim Bo on the bleachers.]
TIM BO: It shook me. But it allowed me to see the truth. That was the point that I knew I had to change something.
3:08-3:18
[Tim Bo doing light exercises in a gym; video pans to Tim Bo drinking water and other activities in the gym.]
TIM BO: In the past, I tried everything. I had a personal trainer. Went to gyms. I even built a gym in my garage.
3:18-3:26
[Tim Bo continues doing light exercises in the gym.]
TIM BO: I was always dedicated to doing something, but I couldn’t get the lasting results that I was looking for.
3:26-3:33
[Tim Bo cutting and styling a client’s hair.]
TIM BO: I make a living making people look and feel good. I needed to find a way to pour back into myself.
3:33-3:47
[Tim Bo styling his client’s hair; pans to Tim Bo in his salon speaking to camera; video pans to Tim Bo doing a photo shoot in his salon.]
TIM BO: When I went to my doctor, I had a full-on assessment. She also explained to me that obesity is a real disease and that I may need a little bit more help than diet and exercise alone. And that’s when I was introduced to Zepbound.
3:47-3:51
[Tim Bo doing a photo shoot in his salon; Tim Bo holding a plate of food, smiling at camera.]
CAPTION: Individual results may vary. Talk to your doctor to see if Zepbound® is right for you.
TIM BO: Since starting Zepbound, along with diet and exercise, I have lost...
3:51-03:57
[Tim Bo looking proud at the track; Tim Bo laughing and styling his client’s hair.]
CAPTION: Throughout a 17-month clinical trial, people who dieted, exercised,* and took Zepbound sustained weight loss—whether taking the 5-mg, 10-mg, or 15-mg dose.†
Zepbound is not for cosmetic weight loss.
*Along with reduced-calorie diet and increased physical activity.
†Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 lbs) on 5 mg, ~13-20% (28-44 lbs) on 10 mg, and ~15-21% (33-48 lbs) on 15 mg compared to ~3% (7 lbs) on placebo. Avg. baseline weights were ~220-233 lbs.
TIM BO: ...a significant amount of weight. And I’m keeping it off. I’m not as hungry.
03:57-4:04
[Tim Bo styling his client’s hair.]
CAPTION: Zepbound is not for cosmetic weight loss.
*Along with reduced-calorie diet and increased physical activity.
†Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 lbs) on 5 mg, ~13-20% (28-44 lbs) on 10 mg, and ~15-21% (33-48 lbs) on 15 mg compared to ~3% (7 lbs) on placebo. Avg. baseline weights were ~220-233 lbs.
TIM BO: I’m eating smaller, more nutritious portions and it’s working. I’ve gone from a 2XL to a Large.
4:05-4:09
[Tim Bo in his salon chair; pans to Tim Bo jogging at the track and then smiling at camera.]
TIM BO: I get up every morning, I jog and workout in my gym at home.
4:09-4:18
[Tim Bo walking along the beach; pans to drone shot of Tim Bo on the beach.]
TIM BO: I love to go to the beach and just listen to the waves. It’s perfect for meditation and relaxation.
4:18-4:31
[Tim Bo walking his dog, Princess; pans to Tim Bo speaking straight to camera from salon chair; Tim Bo smiling and enjoying the moment at the beach.]
TIM BO: I went to my regular doctor and she told me the weight loss is helping. And I’m sitting back and I’m asking myself, why did it take so long to do this?
4:31-4:39
[Tim Bo posing all dressed up for a photo shoot; pans to Tim Bo sitting in salon chair, then back to posing; pans to Tim Bo laughing in the salon chair]
TIM BO: I’m noticing changes now...So I’m enjoying these little moments that are happening, like not having to bend over to see my shoes.
4:39-4:49
[Tim Bo at the photo shoot; pans to Tim Bo speaking to camera in his salon chair.]
TIM BO: I really, really love who I see. As a southern guy, we pour into family and friends. We never put ourselves up front.
4:49-4:52
[Tim Bo looking at camera on the track smiling.]
TIM BO: I’m bound for pouring back into myself.
4:52-5:00
[Tim Bo enjoying a moment on the beach; video pans to Tim Bo in his salon talking to camera. Tim Bo jogging.]
TIM BO: This is my year. The year of Tim Bo. I’m gonna let y’all in on a little secret y’all. I’m just getting started.”
5:00-5:05
[Tim Bo jogging. Animated boundfor logo appears on screen.]
5:05-5:07
[Zepbound end card appears on screen]
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
visit Zepbound.com
or call 1-800-LillyRX
CMAT-19962 03/2026 © Lilly USA, LLC 2026. All rights reserved.
Zepbound®, its delivery device base and KwikPen® are registered trademarks and BoundforTM is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
5:07-5:10
[Animated Lilly Medicine logo appears on screen]
CAPTION: Lilly
A MEDICINE COMPANY
5:10-13:29
[Indications and safety summary appear on screen. The safety information begins scrolling automatically after a short pause.]
CAPTION: INDICATIONS AND SAFETY SUMMARY WITH WARNINGS
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Zepbound® (ZEHP-bownd) is an injectable prescription medicine used with a reduced-calorie diet and increased physical activity to help adults with:
- obesity, or some adults with overweight who also have weight-related medical problems to lose excess body weight and keep the weight off.
- moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA.
Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
Warnings - Zepbound may cause tumors in the thyroid, including thyroid cancer. Watch for possible symptoms, such as a lump or swelling in the neck. hoarseness. trouble swallowing. or shortness of breath. If you have any of these symptoms. tell your healthcare provider.
- Do not use Zepbound if you or any of your family have ever had a type of thyroid cancer called medullary thyroid carcinoma (MTC).
- Do not use Zepbound if you have Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
- Do not use Zepbound if you have had a serious allergic reaction to tirzepatide or any of the ingredients in Zepbound.
KwikPen®: Do not share your KwikPen with other people, even if the pen needle has been changed. You may give other people a serious infection or get a serious infection from them.
Zepbound may cause serious side effects, including:
Severe stomach problems. Stomach problems, sometimes severe, have been reported in people who use Zepbound. Tell your healthcare provider if you have stomach problems that are severe or will not go away.
Dehydration leading to kidney problems. Diarrhea, nausea, and vomiting may cause a loss of fluids (dehydration), which may cause kidney problems. It is important for you to drink fluids to help reduce your chance of dehydration. Tell your healthcare provider right away if you have nausea, vomiting, or diarrhea that does not go away.
Gallbladder problems. Gallbladder problems have happened in some people who use Zepbound. Tell your healthcare provider right away if you get symptoms of gallbladder problems, which may include pain in your upper stomach (abdomen), fever, yellowing of skin or eyes (jaundice), or clay-colored stools.
Inflammation of the pancreas (pancreatitis). Stop using Zepbound and call your healthcare provider right away. If you have severe pain in your stomach area (abdomen) that will not go away, with or without nausea or vomiting. You may feel the pain from your abdomen to your back.
Serious allergic reactions. Stop using Zepbound and get medical help right away if you have any symptoms of a serious allergic reaction, including swelling of your face, lips, tongue or throat, problems breathing or swallowing, severe rash or itching, fainting or feeling dizzy, or very rapid heartbeat.
Low blood sugar (hypoglycemia). Your risk for getting low blood sugar may be higher if you use Zepbound with medicines that can cause low blood sugar, such as a sulfonylurea or insulin. Signs and symptoms of low blood sugar may include dizziness or light-headedness, sweating, confusion or drowsiness, headache, blurred vision, slurred speech, shakiness, fast heartbeat, anxiety, irritability, mood changes, hunger, weakness or feeling jittery.
Changes in vision in patients with type 2 diabetes. Tell your healthcare provider if you have changes in vision during treatment with Zepbound.
Food or liquid getting into the lungs during surgery or other procedures that use anesthesia or deep sleepiness (deep sedation). Zepbound may increase the chance of food getting into your lungs during surgery or other procedures. Tell all your healthcare providers that you are taking Zepbound before you are scheduled to have surgery or other procedures.
Common side effects
The most common side effects of Zepbound include nausea, diarrhea, vomiting, constipation, stomach (abdominal) pain, indigestion, injection site reactions, feeling tired, allergic reactions, belching, hair loss, and heartburn. These are not all the possible side effects of Zepbound. Talk to your healthcare provider about any side effect that bothers you or doesn't go away.
Tell your doctor if you have any side effects. You can report side effects at 1-800-FDA-1088 or www.fda.gov/medwatch.
CAPTION:
Before using Zepbound
- Your healthcare provider should show you how to use Zepbound before you use it for the first time.
- Talk to your healthcare provider about low blood sugar and how to manage it. Tell your healthcare provider if you are taking medicines to treat diabetes, including an insulin or sulfonylurea.
- If you take birth control pills by mouth, talk to your healthcare provider before you use Zepbound. Birth control pills may not work as well while using Zepbound. Your healthcare provider may recommend another type of birth control for 4 weeks after you start Zepbound and for 4 weeks after each increase in your dose of Zepbound.
Review these questions with your healthcare provider:
- Do you have other medical conditions, including problems with your pancreas, or severe problems with your stomach, such as slowed emptying of your stomach (gastroparesis) or problems digesting food?
- Do you take diabetes medicines such as insulin or sulfonylureas?
- Do you have a history of diabetic retinopathy?
- Are you scheduled to have surgery or other procedures that use anesthesia or deep sleepiness (deep sedation)?
- Do you take any other prescription medicines or over-the-counter drugs, vitamins or herbal supplements?
- Are you pregnant, plan to become pregnant, breastfeeding or plan to breastfeed? Zepbound may harm your unborn baby. Tell your healthcare provider if you become pregnant while using Zepbound. Zepbound may pass into your breast milk. You should talk with your healthcare provider about the best way to feed your baby while using Zepbound.
- Pregnancy Exposure Registry: There will be a pregnancy exposure registry for women who have taken Zepbound during pregnancy. The purpose of this registry is to collect information about the health of you and your baby. Talk to your healthcare provider about how you can take part in this registry, or you may contact Lilly at 1-800-LillyRx (1-800-545-5979).
How to take
- Read the Instructions for Use that come with Zepbound.
- Use Zepbound exactly as your healthcare provider says.
- Use Zepbound with a reduced-calorie diet and increased physical activity.
- Inject Zepbound under the skin (subcutaneously) of your stomach (abdomen), thigh, or have another person inject in the back of the upper arm. Do not inject ZEPBOUND into a muscle (intramuscularly) or vein (intravenously).
- Use Zepbound 1 time each week, at any time of the day.
- Change (rotate) your injection site with each weekly injection. Do not use the same site for each injection.
If you take too much Zepbound, call your healthcare provider, call the Poison Help line at 1-800-222-1222 or go to the nearest hospital emergency room right away.
Zepbound is approved as a 2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, and 15 mg injection.
Learn more
Zepboundisaprescriptionmedicine.Formoreinformation,call 1-800-LillyRx (1-800-545-5979)orgoto www.zepbound.lilly.com.
This summary provides basic information about Zepbound but does not include all information known about this medicine. Read the information that comes with your prescription each time your prescription is filled. This information does not take the place of talking with your healthcare provider. Be sure to talk to your healthcare provider about Zepbound and how to take it. Your healthcare provider is the best person to help you decide if Zepbound is right for you.
ZP CON BS 25FEB2026
Zepbound®, its delivery device base and KwikPen® are registered trademarks and BoundforTM is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
Voice over generated by AI.
13:29-13:31
[Zepbound end card appears on screen, including the Zepbound logo, dosing information, and trademark information.]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
visit Zepbound.com
or call 1-800-LillyRx
CMAT-19962 03/2026 © Lilly USA, LLC 2026. All rights reserved.
Zepbound®, its delivery device base and KwikPen® are registered trademarks and BoundforTM is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
13:31-13:34
[Animated Lilly Medicine logo appears on screen in white text on a red background.]
CAPTION: Lilly
A MEDICINE COMPANY
Tim Bo
00:00-00:05
[Intro sequence appears of waves breaking onto a beach. The sea extends till the horizon with small sailboats peppered here and there.]
CAPTION: Please see the safety information before Noelle’s story.
00:05-00:09
[Zepbound logo appears across the screen.]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
00:09-00:46
[The Zepbound logo and dosage information move to the top left of the screen. A countdown appears on the top right of the screen, counting down from one minute and fourteen seconds till Noelle’s story begins. The Indication statement appears and remains on-screen till the narrator concludes.]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Hear Noelle’s story in 00:01:14
Zepbound is an injectable prescription medicine that may help adults with obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off. It may also help adults with moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA. It should be used with a reduced-calorie diet and increased physical activity.
- Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines.
- It is not known if Zepbound is safe and effective for use in children.
00:46-01:25
[The Zepbound logo and the countdown timer remain locked in place at the top left and top right of the screen, respectively. The countdown indicates Noelle’s story will start in 37 seconds. The Indication statement gives way to the Select Safety Information and stays on screen till the narrator concludes.]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Hear Noelle’s story in 00:00:37
Select Safety Information.
Warning:
Tell your healthcare provider if you get a lump or swelling in your neck, hoarseness, trouble swallowing, or shortness of breath. These may be symptoms of thyroid cancer. In studies with rats, Zepbound and medicines that work like Zepbound caused thyroid tumors, including thyroid cancer. It is not known if Zepbound will cause thyroid tumors, or a type of thyroid cancer called medullary thyroid carcinoma (MTC) in people. Do not take Zepbound if you or any of your family have ever had MTC or if you have an endocrine system condition called Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
01:25-01:34
[Ambient music, ocean waves, and seagull sounds play in the background; Noelle standing on a beach, looking out at the sea.]
NOELLE: I was stuck for 15 to probably 18 years. I tried multiple trends to lose weight and nothing would work.
Caption: Noelle was a Zepbound clinical trial participant and was compensated for her time. Individual results may vary. Talk to your doctor to see if Zepbound® is right for you.
01:35-01:45
[Noelle is on screen speaking to the camera. She is sitting on a couch in a well-lit room. The scene changes to show Noelle and her friends working out at the beach.]
NOELLE: Up until I was 30, I was pretty athletic, slender, I was always out with my friends doing fun things, so I stayed pretty thin.
01:45-01:51
[Noelle continues speaking to the camera.]
NOELLE: Well, once I had a baby, I was putting on five, ten pounds a year.
01:51-01:59
[The scene shows a close up of Noelle exercising on the beach alone, looking reflective. The scene cuts to show Noelle on screen, as she continues to speak to the camera.]
NOELLE: It sneaks up on you, you know. And after turning 40, it was impossible for me to lose weight.
01:59-02:09
[Noelle and her friends are working out at the beach together.]
NOELLE: I would start a diet. I'd lose weight. Then I'd hit a certain point and it just would stop coming off. And then I finally went to my doctor for help.
02:09-02:33
[Noelle continues speaking to the screen. We see a couple of pictures of Noelle with her son.]
NOELLE: They told me I was overweight and that I had high blood pressure. For myself, for my son, and for my family, there needed to be a change. When taking Zepbound, along with diet and exercise, I was able to lose significant weight and maintain my weight loss during the trial.
CAPTION: Individual results may vary. Talk to your doctor to see if Zepbound® is right for you.
Throughout a 17-month clinical trial, people who dieted, exercised,* and took Zepbound sustained weight loss-whether taking the 5-mg, 10-mg, or 15-mg dose.†
Zepbound is not for cosmetic weight loss.
Along with reduced-calorie diet and increased physical activity. Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 Ibs) on 5 mg, ~13-20% (28-44 Ibs) on 10 mg, and ~15-21% (33-48 Ibs) on 15 mg compared to ~3% (7 Ibs) on placebo. Avg. baseline weights were ~220-233 Ibs.
02:33-02:44
[Pictures from Noelle’s weight loss journey after she started taking Zepbound appear on the screen.]
NOELLE: I was a size 22. As I started taking the medication and went down to size 18 and then eventually 16 and 14.
CAPTION: Throughout a 17-month clinical trial, people who dieted, exercised,* and took Zepbound sustained weight loss-whether taking the 5-mg, 10-mg, or 15-mg dose.†
Zepbound is not for cosmetic weight loss.
Along with reduced-calorie diet and increased physical activity. Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 Ibs) on 5 mg, ~13-20% (28-44 Ibs) on 10 mg, and ~15-21% (33-48 Ibs) on 15 mg compared to ~3% (7 Ibs) on placebo. Avg. baseline weights were ~220-233 Ibs.
02:44-03:01
[Noelle doing Zumba in the backyard.]
NOELLE: When I eventually get down to 12, I was like, this is the most exciting thing ever. I feel seen. I love dancing, so, you know, hey, I'm too old to go to the nightclubs. Oh, my nightclub is Zumba.
CAPTION: Zepbound is not for cosmetic weight loss.
Along with reduced-calorie diet and increased physical activity. Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 Ibs) on 5 mg, ~13-20% (28-44 Ibs) on 10 mg, and ~15-21% (33-48 Ibs) on 15 mg compared to ~3% (7 Ibs) on placebo. Avg. baseline weights were ~220-233 Ibs.
03:01-03:13
[Ambient sounds of the ocean, Noelle and her friends walking arm in arm along the beach. The scene cuts to show Noelle and her friends enjoying a picnic on the beach.]
NOELLE: I love enjoying the sun and having great food with great friends. And the food is actually good for you.
CAPTION: Zepbound is not for cosmetic weight loss.
Along with reduced-calorie diet and increased physical activity. Individual results may vary. In studies, average weight loss in adults with or without diabetes was ~15% (34 Ibs) on 5 mg, ~13-20% (28-44 Ibs) on 10 mg, and ~15-21% (33-48 Ibs) on 15 mg compared to ~3% (7 Ibs) on placebo. Avg. baseline weights were ~220-233 Ibs.
03:14-03:29
[Noelle continues speaking to the screen. The scene cuts to show her holding a coffee mug with both hands and drinking from it in a backyard space.]
NOELLE: All these times when I was trying to lose weight and couldn’t, I just felt like, well, my body likes the weight. And there's nothing that I can do. And what was surprising with Zepbound was that my body did wanna lose weight.
03:29-03:34
[Noelle holds the coffee mug with both hands and stares into the distance in an open backyard space with lots of natural lighting.]
NOELLE: I would eat half of what I used to eat and feel satisfied.
03:34-03:42
[A compilation plays of Noelle engaging in different activities during her weight loss journey. There are shots of her exercising at the beach, doing Zumba in her backyard, looking up and at the water, and hiking alone on a trail, all the while wearing a smile. The scene cuts to show Noelle back on the couch speaking to the screen]
NOELLE: I feel the best part of this journey is that I am a role model to my child.
03:42-03:59
[Noelle and her son hike down a trail together, talking to each other. They briefly pause to look at each other with fondness and admiration and proceed to take a selfie together. We see the selfie they took as they resume their hike.]
NOELLE: You’re always looking for a new goal to hit, knock that off my bucket list, you know?
I think he's very proud of me. I think he looks at me as inspiration and he knows I'm doing it for him too. I'm proud of myself right now, and I look back at my past self and say, “You go girl!”
04:00-04:05
[Noelle is standing on the beach and turns to look at the camera.]
NOELLE: I'm bound for new ways to celebrate the love I have for myself.
CAPTION: boundforTM
04:05-04:08
[Animated Zepbound logo appears on screen]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Visit zepbound.lilly.com
or call 1-800-LillyRX for pricing information
CMAT-19971 03/2026 © Lilly USA, LLC 2026. All rights reserved.
Zepbound®, its delivery device base and KwikPen® are registered trademarks and Boundfor TM is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
04:08-04:10
[The Eli Lilly logo appears in white on a red background.]
CAPTION: Lilly
A MEDICINE COMPANY
04:10-12:31
[The Indication and Safety Summary with Warning of Zepbound appears across the screen and starts scrolling automatically after a short pause. The Zepbound logo and dosing information stay static at the top left of the screen.]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, 15 mg
A Lilly Medicine
CAPTION: INDICATIONS AND SAFETY SUMMARY WITH WARNINGS
Zepbound® (ZEHP-bownd) is an injectable prescription medicine used with a reduced-calorie diet and increased physical activity to help adults with:
- obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off.
- moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA.
Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
Warnings - Zepbound may cause tumors in the thyroid, including thyroid cancer. Watch for possible symptoms, such as a lump or swelling in the neck, hoarseness, trouble swallowing, or shortness of breath. If you have any of these symptoms, tell your healthcare provider.
- Do not use Zepbound if you or any of your family have ever had a type of thyroid cancer called medullary thyroid carcinoma (MTC).
- Do not use Zepbound if you have Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
- Do not use Zepbound if you have had a serious allergic reaction to tirzepatide or any of the ingredients in Zepbound.
KwikPen®: Do not share your KwikPen with other people, even if the pen needle has been changed. You may give other people a serious infection or get a serious infection from them.
Zepbound may cause serious side effects, including:
Severe stomach problems. Stomach problems, sometimes severe, have been reported in people who use Zepbound. Tell your healthcare provider if you have stomach problems that are severe or will not go away.
Dehydration leading to kidney problems. Diarrhea, nausea, and vomiting may cause a loss of fluids (dehydration), which may cause kidney problems. It is important for you to drink fluids to help reduce your chance of dehydration. Tell your healthcare provider right away if you have nausea, vomiting, or diarrhea that does not go away.
Gallbladder problems. Gallbladder problems have happened in some people who use Zepbound. Tell your healthcare provider right away if you get symptoms of gallbladder problems, which may include pain in your upper stomach (abdomen), fever, yellowing of skin or eyes (jaundice), or clay-colored stools.
Inflammation of the pancreas (pancreatitis). Stop using Zepbound and call your healthcare provider right away if you have severe pain in your stomach area (abdomen) that will not go away, with or without nausea or vomiting. You may feel the pain from your abdomen to your back.
Serious allergic reactions. Stop using Zepbound and get medical help right away if you have any symptoms of a serious allergic reaction, including swelling of your face, lips, tongue or throat, problems breathing or swallowing, severe rash or itching, fainting or feeling dizzy, or very rapid heartbeat.
Low blood sugar (hypoglycemia). Your risk for getting low blood sugar may be higher if you use Zepbound with medicines that can cause low blood sugar, such as a sulfonylurea or insulin. Signs and symptoms of low blood sugar may include dizziness or light-headedness, sweating, confusion or drowsiness, headache, blurred vision, slurred speech, shakiness, fast heartbeat, anxiety, irritability, mood changes, hunger, weakness or feeling jittery.
Changes in vision in patients with type 2 diabetes. Tell your healthcare provider if you have changes in vision during treatment with Zepbound.
Food or liquid getting into the lungs during surgery or other procedures that use anesthesia or deep
sleepiness (deep sedation). Zepbound may increase the chance of food getting into your lungs during surgery or other procedures. Tell all your healthcare providers that you are taking Zepbound before you are scheduled to have surgery or other procedures.
Common side effects
The most common side effects of Zepbound include nausea, diarrhea, vomiting, constipation, stomach
(abdominal) pain, indigestion, injection site reactions, feeling tired, allergic reactions, belching, hair loss, and heartburn. These are not all the possible side effects of Zepbound. Talk to your healthcare provider about any side effect that bothers you or doesn’t go away.
Tell your doctor if you have any side effects. You can report side effects at 1-800-FDA-1088 or www.fda.gov/medwatch.
Before using Zepbound
• Your healthcare provider should show you how to use Zepbound before you use it for the first time.
• Talk to your healthcare provider about low blood sugar and how to manage it. Tell your
healthcare provider if you are taking medicines to treat diabetes including an insulin or
sulfonylurea.
• If you take birth control pills by mouth, talk to your healthcare provider before you use
Zepbound. Birth control pills may not work as well while using Zepbound. Your healthcare
provider may recommend another type of birth control for 4 weeks after you start Zepbound
and for 4 weeks after each increase in your dose of Zepbound.
Review these questions with your healthcare provider:
❑ Do you have other medical conditions, including problems with your pancreas, or
severe problems with your stomach, such as slowed emptying of your stomach (gastroparesis) or
problems digesting food?
❑ Do you take diabetes medicines, such as insulin or sulfonylureas?
❑ Do you have a history of diabetic retinopathy?
❑ Are you scheduled to have surgery or other procedures that use anesthesia or deep sleepiness (deep sedation)?
❑ Do you take any other prescription medicines or over-the-counter drugs, vitamins, or herbal
supplements?
❑ Are you pregnant, plan to become pregnant, breastfeeding, or plan to breastfeed? Zepbound
may harm your unborn baby. Tell your healthcare provider if you become pregnant while using
Zepbound. Zepbound may pass into your breast milk. You should talk with your healthcare provider about the best way to feed your baby while using Zepbound.
• Pregnancy Exposure Registry: There will be a pregnancy exposure registry for women who
have taken Zepbound during pregnancy. The purpose of this registry is to collect information
about the health of you and your baby. Talk to your healthcare provider about how you can
take part in this registry, or you may contact Lilly at 1-800-LillyRx (1-800-545-5979).
How to take
- Read the Instructions for Use that come with Zepbound.
- Use Zepbound exactly as your healthcare provider says.
- Use Zepbound with a reduced-calorie diet and increased physical activity.
- Inject Zepbound under the skin (subcutaneously) of your stomach (abdomen), thigh, or have another person inject in the back of the upper arm. Do not inject ZEPBOUND into a muscle (intramuscularly) or vein (intravenously).
- Use Zepbound 1 time each week, at any time of the day.
- Change (rotate) your injection site with each weekly injection. Do not use the same site for each injection.
If you take too much Zepbound, call your healthcare provider, call the Poison Help line at 1-800-222-1222 or go to the nearest hospital emergency room right away.
Zepbound is approved as a 2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, and 15 mg injection.
Learn more
Zepbound is a prescription medicine. For more information, call 1-800-LillyRx (1-800-545-5979) or go
This summary provides basic information about Zepbound but does not include all information known about this medicine. Read the information that comes with your prescription each time your prescription is filled. This information does not take the place of talking with your healthcare provider. Be sure to talk to your healthcare provider about Zepbound and how to take it. Your healthcare provider is the best person to help you decide if Zepbound is right for you.
ZP CON BS 25FEB2026
Zepbound®, its delivery device base and KwikPen® are registered trademarks owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
Voice over generated by AI.
12:31-12:35
[Animated Zepbound logo appears on screen]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Visit zepbound.lilly.com
or call 1-800-LillyRX for pricing information
CMAT-19971 03/2026 © Lilly USA, LLC 2026. All rights reserved
Zepbound®, its delivery device base and KwikPen® are registered trademarks and BoundforTM is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
12:36-12:38
[The Eli Lilly logo appears in white on a red background.]
CAPTION: Lilly
A MEDICINE COMPANY
Noelle
00:00-00:04
[The video begins with upbeat music and a voice-over by Tim Bo. Some texts appear on the screen along with a selfie shot of Tim Bo on a green background.]
TIM BO: Hi, I’m Tim Bo and today, I’m going to share more about my Zepbound journey.
CAPTION:
Let’s Check In With
Tim Bo
A REAL ZEPBOUND PATIENT
Tim Bo is a Zepbound patient and was compensated for his time.
Individual results may vary. Talk to your doctor to see if Zepbound is right for you.
CAPTION:
My Daughter’s
Sweet 16
Birthday Party
00:05-00:38
[The screen transitions to Zepbound’s Indication and Limitations of Use, which appear as black-colored text on a white background. A countdown timer for the start of the episode appears on the right side of the screen as the narration of the Indication and Limitations of Use begins.]
NARRATOR:
Zepbound is an injectable prescription medicine that may help adults with obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off. Zepbound should be used with a reduced-calorie diet and increased physical activity. Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Episode starts in: 00:01:17
00:39-01:21
[The narration of the Select Safety Information begins as some new text appear on the screen and the countdown to the start of the episode continues.]
NARRATOR:
Select Safety Information
Warning:
Tell your healthcare provider if you get a lump or swelling in your neck, hoarseness, trouble swallowing, or shortness of breath. These may be symptoms of thyroid cancer. In studies with rats, Zepbound and medicines that work like Zepbound cause thyroid tumors, including thyroid cancer. It is not known if Zepbound will cause thyroid tumors, or a type of thyroid cancer called medullary thyroid carcinoma (MTC) in people. Do not take Zepbound if you or any of your family have ever had MTC or if you have an endocrine system condition called Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
See Indications and Safety Summary with Warnings at the end of this video.
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Episode starts in 00:00:42
01:22-01:32
[The screen cuts to a couple of snapshots of Tim Bo smiling and posing as the background music continues and some new text appears.]
CAPTION:
Tim Bo struggled to lose weight for years, despite dieting and exercising. Now he is taking Zepbound and he's sharing moments from his weight loss journey.
01:33-01:52
[The scene begins with a picture of Tim Bo with his daughter. The Zepbound logo appears at the top right-side of the screen. Tim starts narrating in the background as a few pictures of his daughter’s 16th birthday celebrations appear on the screen.]
TIM BO: I have a 16-year old now, and it’s awesome to be able to connect with her. I was actually able to do that at a big celebration, which we call her Sweet 16. To celebrate this huge milestone for my daughter, for my princess, it had to be extra, extra, extra special.
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
01:53-02:05
[A photo of Tim and his wife zooms in, then cuts to them walking hand in hand at their daughter's 16th birthday party in a ballroom while Tim continues to narrate in the background. This scene is followed by a couple of snapshots of Tim dancing with his daughter. The Zepbound logo remains static at the top right-side of the screen.]
TIM BO: I remember walking into the ballroom to dance with her and her to be able to wrap her hands completely around me. I always want to be her biggest dance partner.
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
02:06-02:08
[The screen cuts to a shot of Tim smiling while looking at the camera.]
CAPTION:
what are you
boundfor™
02:09-02:10
[Some texts appear on a white background.]
CAPTION:
Hear Tim Bo’s Full Story at
www.boundfor.com
02:11-02:15
[The screen fades to Zepbound indication and copyright statement on a white background.]
CAPTION:
zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Visit Zepbound.com
or call 1-800-LillyRx for pricing information
CMAT-19975 04/2026 © Lilly USA, LLC. 2026. All rights reserved.
Zepbound® is a registered trademark and boundfor™ is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
02:16-02:19
[Lilly A Medicine Company appears in white text on a red background.]
CAPTION:
Lilly
A MEDICINE COMPANY
02:20-10:36
[The screen transitions into Indications and Safety Summary with Warnings, which appear in the form of scrolling text, while narration begins in the background. The Zepbound logo appears at the top right-side of the screen.]
CAPTION: INDICATIONS AND SAFETY SUMMARY WITH WARNINGS
Zepbound® (ZEHP-bownd) is an injectable prescription medicine used with a reduced-calorie diet and increased physical activity to help adults with:
- obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off.
- moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA.
Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
Warnings - Zepbound may cause tumors in the thyroid, including thyroid cancer. Watch for possible symptoms, such as a lump or swelling in the neck, hoarseness, trouble swallowing, or shortness of breath. If you have any of these symptoms, tell your healthcare provider.
• Do not use Zepbound if you or any of your family have ever had a type of thyroid cancer called
medullary thyroid carcinoma (MTC).
• Do not use Zepbound if you have Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
• Do not use Zepbound if you have had a serious allergic reaction to tirzepatide or any of the
ingredients in Zepbound.
KwikPen®: Do not share your KwikPen with other people, even if the pen needle has been changed. You may give other people a serious infection or get a serious infection from them.
Zepbound may cause serious side effects, including:
Severe stomach problems. Stomach problems, sometimes severe, have been reported in people who use Zepbound. Tell your healthcare provider if you have stomach problems that are severe or will not go away.
Dehydration leading to kidney problems. Diarrhea, nausea, and vomiting may cause a loss of fluids (dehydration), which may cause kidney problems. It is important for you to drink fluids to help reduce your chance of dehydration. Tell your healthcare provider right away if you have nausea, vomiting, or diarrhea that does not go away.
Gallbladder problems. Gallbladder problems have happened in some people who use Zepbound. Tell your healthcare provider right away if you get symptoms of gallbladder problems, which may include pain in your upper stomach (abdomen), fever, yellowing of skin or eyes (jaundice), or clay-colored stools.
Inflammation of the pancreas (pancreatitis). Stop using Zepbound and call your healthcare provider right away if you have severe pain in your stomach area (abdomen) that will not go away, with or without nausea or vomiting. You may feel the pain from your abdomen to your back.
Serious allergic reactions. Stop using Zepbound and get medical help right away if you have any symptoms of a serious allergic reaction, including swelling of your face, lips, tongue or throat, problems breathing or swallowing, severe rash or itching, fainting or feeling dizzy, or very rapid heartbeat.
Low blood sugar (hypoglycemia). Your risk for getting low blood sugar may be higher if you use Zepbound with medicines that can cause low blood sugar, such as a sulfonylurea or insulin. Signs and symptoms of low blood sugar may include dizziness or light-headedness, sweating, confusion or drowsiness, headache, blurred vision, slurred speech, shakiness, fast heartbeat, anxiety, irritability, mood changes, hunger, weakness or feeling jittery.
Changes in vision in patients with type 2 diabetes. Tell your healthcare provider if you have changes in vision during treatment with Zepbound.
Food or liquid getting into the lungs during surgery or other procedures that use anesthesia or deep sleepiness (deep sedation). Zepbound may increase the chance of food getting into your lungs during surgery or other procedures. Tell all your healthcare providers that you are taking Zepbound before you are scheduled to have surgery or other procedures.
Common side effects
The most common side effects of Zepbound include nausea, diarrhea, vomiting, constipation, stomach (abdominal) pain, indigestion, injection site reactions, feeling tired, allergic reactions, belching, hair loss, and heartburn. These are not all the possible side effects of Zepbound. Talk to your healthcare provider about any side effect that bothers you or doesn’t go away.
Tell your doctor if you have any side effects. You can report side effects at 1-800-FDA-1088 or www.fda.gov/medwatch.
Before using Zepbound
- Your healthcare provider should show you how to use Zepbound before you use it for the first time.
- Talk to your healthcare provider about low blood sugar and how to manage it. Tell your healthcare provider if you are taking medicines to treat diabetes including an insulin or sulfonylurea.
- If you take birth control pills by mouth, talk to your healthcare provider before you use Zepbound. Birth control pills may not work as well while using Zepbound. Your healthcare provider may recommend another type of birth control for 4 weeks after you start Zepbound and for 4 weeks after each increase in your dose of Zepbound.
Review these questions with your healthcare provider:
❑ Do you have other medical conditions, including problems with your pancreas, or
severe problems with your stomach, such as slowed emptying of your stomach (gastroparesis) or
problems digesting food?
❑ Do you take diabetes medicines, such as insulin or sulfonylureas?
❑ Do you have a history of diabetic retinopathy?
❑ Are you scheduled to have surgery or other procedures that use anesthesia or deep sleepiness (deep sedation)?
❑ Do you take any other prescription medicines or over-the-counter drugs, vitamins, or herbal
supplements?
❑ Are you pregnant, plan to become pregnant, breastfeeding, or plan to breastfeed? Zepbound
may harm your unborn baby. Tell your healthcare provider if you become pregnant while using
Zepbound. Zepbound may pass into your breast milk. You should talk with your healthcare provider about the best way to feed your baby while using Zepbound.
• Pregnancy Exposure Registry: There will be a pregnancy exposure registry for women who
have taken Zepbound during pregnancy. The purpose of this registry is to collect information
about the health of you and your baby. Talk to your healthcare provider about how you can
take part in this registry, or you may contact Lilly at 1-800-LillyRx (1-800-545-5979).
How to take
- Read the Instructions for Use that come with Zepbound.
- Use Zepbound exactly as your healthcare provider says.
- Use Zepbound with a reduced-calorie diet and increased physical activity.
- Inject Zepbound under the skin (subcutaneously) of your stomach (abdomen), thigh, or have another person inject in the back of the upper arm. Do not inject ZEPBOUND into a muscle (intramuscularly) or vein (intravenously).
- Use Zepbound 1 time each week, at any time of the day.
- Change (rotate) your injection site with each weekly injection. Do not use the same site for each injection.
If you take too much Zepbound, call your healthcare provider, call the Poison Help line at 1-800-222-1222 or go to the nearest hospital emergency room right away.
Zepbound is approved as a 2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, and 15 mg injection.
Learn more
Zepbound is a prescription medicine. For more information, call 1-800-LillyRx (1-800-545-5979) or go to www.zepbound.lilly.com.
This summary provides basic information about Zepbound but does not include all information known about this medicine. Read the information that comes with your prescription each time your prescription is filled. This information does not take the place of talking with your healthcare provider. Be sure to talk to your healthcare provider about Zepbound and how to take it. Your healthcare provider is the best person to help you decide if Zepbound is right for you.
ZP CON BS 25FEB2026
Zepbound®, its delivery device base, and KwikPen® are registered trademarks owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
CAPTION:
Lilly
A MEDICINE COMPANY
Voice over generated by AI.
00:00–00:03
(Heather appears in a Zepbound-themed box/frame. A short-form “check-in” opener plays.)
HEATHER: Hi, my name is Heather and I'm going to talk to you about my Zepbound journey.
CAPTION: Let’s check in with Heather. A real Zepbound patient
Heather is a Zepbound patient and was compensated for her time. Individual results may vary. Talk to your doctor to see if Zepbound is right for you.
Zepbound is not for cosmetic weight loss.
CAPTION: Love shopping for new clothes At A New Size
00:04–00:39
(Zepbound logo appears along with a countdown timer indicating the time remaining till the start of the episode. Indication and limitations of use segment begin.)
Narrator: Indications and limitations of use.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Episode starts in: 00:01:17
Zepbound is an injectable prescription medicine that may help adults with obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off. Zepbound should be used with a reduced-calorie diet and increased physical activity.
Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
Zepbound is not for cosmetic weight loss.
00:40–01:21
[Zepbound logo continues. Text overlays “Select Safety Information.”]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Episode starts in: 00:00:41
Select safety information.
Warning:
Tell your healthcare provider if you get a lump or swelling in your neck, hoarseness, trouble swallowing, or shortness of breath. These may be symptoms of thyroid cancer. In studies with rats, Zepbound and medicines that work like Zepbound cause thyroid tumors, including thyroid cancer. It is not known if Zepbound will cause thyroid tumors or a type of thyroid cancer called medullary thyroid carcinoma (MTC) in people. Do not take Zepbound if you or any of your family have ever had MTC or if you have an endocrine system condition called Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
See Indications and Safety Summary with Warnings at the end of this video.
Zepbound is not for cosmetic weight loss.
01:22–01:31
(Heather shops for clothes; photos and polaroids appear.)
HEATHER: My doctor said and recognized that diet and exercise weren't working for me alone, so he put in the recommendation for Zepbound.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
“My doctor said and recognized that diet and exercise weren't working for me alone. So he put in the recommendation for Zepbound.”
Along with reduced-calorie diet and increased physical activity.
Zepbound is not for cosmetic weight loss.
01:32–1.43
(Heather is sitting and talking)
HEATHER: So, I've been shopping more because I've needed to replenish my closet. So, when I go shopping now, I still catch myself going towards like the plus size section.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
“I've needed to replenish my closet. When I go shopping…”
“I still catch myself going towards the plus size section.”
Zepbound is not for cosmetic weight loss.
01:43–01:48
(Heather pictures slide on to the screen.)
HEATHER: And then I have to look at things like, oh wait, that’s not where I’m at anymore.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
“But that is not where I am at anymore”
Zepbound is not for cosmetic weight loss.
01:48–02:00
(Heather pictures slide on to the screen.)
HEATHER: Now I’m in a more standard size, and it is so refreshing because I haven’t been in those sizes in over a decade.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Zepbound is not for cosmetic weight loss.
02:00-02:10
(Heather is sitting and talking)
HEATHER: Before, I avoided the dressing rooms with every fiber of my body. I did not want to go and be able to see myself from multiple angles.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Zepbound is not for cosmetic weight loss.
02:10-02:32
(Heather pictures slide on to the screen.)
HEATHER: Now, I’m not so concerned with that. I was in the dressing room the other day, and with the mirrors on both sides and in the front, I was looking at myself and I’m like, wow, I’ve made so much progress. I’ve put in so much work and I’m just so proud of myself. It gave me a greater appreciation of the journey that I’ve been on.
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Zepbound is not for cosmetic weight loss.
02:32–02:34
(Smiling Heather comes on the screen)
CAPTION:
What are you boundforTM
Zepbound is not for cosmetic weight loss.
02:34–02:40
(Text appears on the screen)
CAPTION:
Hear Heather’s Full Story at www.boundfor.com
Zepbound is not for cosmetic weight loss.
02:40-02:43
(Logo along with the footnote appears on the screen)
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
Visit Zepbound.com
or call 1-800-LillyRx for pricing information
CMAT-19974 04/2026 © Lilly USA, LLC. 2026. All rights reserved.
Zepbound®, its delivery device base and KwikPen® are registered trademarks and BoundforTM is a trademark owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
02:43-02:46
[Lilly A Medicine Company logo appears.]
CAPTION: Lilly
A Medicine Company
02:46–11:07
[Indications and Safety Summary with Warnings scrolls on screen.]
CAPTION:
Zepbound®
(tirzepatide) injection 0.5 mL or 0.6 mL
2.5 mg | 5 mg | 7.5 mg | 10 mg | 12.5 mg | 15 mg
A Lilly Medicine
CAPTION: INDICATIONS AND SAFETY SUMMARY WITH WARNINGS
Zepbound® (ZEHP-bownd) is an injectable prescription medicine used with a reduced-calorie diet and increased physical activity to help adults with:
- obesity, or some adults with overweight who also have weight-related medical problems, to lose excess body weight and keep the weight off.
- moderate-to-severe obstructive sleep apnea (OSA) and obesity to improve their OSA.
Zepbound contains tirzepatide and should not be used with other tirzepatide-containing products or any GLP-1 receptor agonist medicines. It is not known if Zepbound is safe and effective for use in children.
Warnings - Zepbound may cause tumors in the thyroid, including thyroid cancer. Watch for possible symptoms, such as a lump or swelling in the neck, hoarseness, trouble swallowing, or shortness of breath. If you have any of these symptoms, tell your healthcare provider.
- Do not use Zepbound if you or any of your family have ever had a type of thyroid cancer called medullary thyroid carcinoma (MTC).
- Do not use Zepbound if you have Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).
- Do not use Zepbound if you have had a serious allergic reaction to tirzepatide or any of the ingredients in Zepbound.
KwikPen®: Do not share your KwikPen with other people, even if the pen needle has been changed. You may give other people a serious infection or get a serious infection from them.
Zepbound may cause serious side effects, including:
Severe stomach problems. Stomach problems, sometimes severe, have been reported in people who use Zepbound. Tell your healthcare provider if you have stomach problems that are severe or will not go away.
Dehydration leading to kidney problems. Diarrhea, nausea, and vomiting may cause a loss of fluids (dehydration), which may cause kidney problems. It is important for you to drink fluids to help reduce your chance of dehydration. Tell your healthcare provider right away if you have nausea, vomiting, or diarrhea that does not go away.
Gallbladder problems. Gallbladder problems have happened in some people who use Zepbound. Tell your healthcare provider right away if you get symptoms of gallbladder problems, which may include pain in your upper stomach (abdomen), fever, yellowing of skin or eyes (jaundice), or clay-colored stools.
Inflammation of the pancreas (pancreatitis). Stop using Zepbound and call your healthcare provider right away if you have severe pain in your stomach area (abdomen) that will not go away, with or without nausea or vomiting. You may feel the pain from your abdomen to your back.
Serious allergic reactions. Stop using Zepbound and get medical help right away if you have any symptoms of a serious allergic reaction, including swelling of your face, lips, tongue or throat, problems breathing or swallowing, severe rash or itching, fainting or feeling dizzy, or very rapid heartbeat.
Low blood sugar (hypoglycemia). Your risk for getting low blood sugar may be higher if you use Zepbound with medicines that can cause low blood sugar, such as a sulfonylurea or insulin. Signs and symptoms of low blood sugar may include dizziness or light-headedness, sweating, confusion or drowsiness, headache, blurred vision, slurred speech, shakiness, fast heartbeat, anxiety, irritability, mood changes, hunger, weakness or feeling jittery.
Changes in vision in patients with type 2 diabetes. Tell your healthcare provider if you have changes in vision during treatment with Zepbound.
Food or liquid getting into the lungs during surgery or other procedures that use anesthesia or deep sleepiness (deep sedation). Zepbound may increase the chance of food getting into your lungs during surgery or other procedures. Tell all your healthcare providers that you are taking Zepbound before you are scheduled to have surgery or other procedures.
Common side effects
The most common side effects of Zepbound include nausea, diarrhea, vomiting, constipation, stomach (abdominal) pain, indigestion, injection site reactions, feeling tired, allergic reactions, belching, hair loss, and heartburn. These are not all the possible side effects of Zepbound. Talk to your healthcare provider about any side effect that bothers you or doesn’t go away.
Tell your doctor if you have any side effects. You can report side effects at 1-800-FDA-1088 or www.fda.gov/medwatch.
Before using Zepbound
• Your healthcare provider should show you how to use Zepbound before you use it for the first time.
• Talk to your healthcare provider about low blood sugar and how to manage it. Tell your healthcare provider if you are taking medicines to treat diabetes including an insulin or sulfonylurea.
• If you take birth control pills by mouth, talk to your healthcare provider before you use
Zepbound. Birth control pills may not work as well while using Zepbound. Your healthcare
provider may recommend another type of birth control for 4 weeks after you start Zepbound
and for 4 weeks after each increase in your dose of Zepbound.
Review these questions with your healthcare provider:
❑ Do you have other medical conditions, including problems with your pancreas, or severe problems with your stomach, such as slowed emptying of your stomach (gastroparesis) or problems digesting food?
❑ Do you take diabetes medicines, such as insulin or sulfonylureas?
❑ Do you have a history of diabetic retinopathy?
❑ Are you scheduled to have surgery or other procedures that use anesthesia or deep sleepiness (deep sedation)?
❑ Do you take any other prescription medicines or over-the-counter drugs, vitamins, or herbal
supplements?
❑ Are you pregnant, plan to become pregnant, breastfeeding, or plan to breastfeed? Zepbound may harm your unborn baby. Tell your healthcare provider if you become pregnant while using Zepbound. Zepbound may pass into your breast milk. You should talk with your healthcare provider about the best way to feed your baby while using Zepbound.
• Pregnancy Exposure Registry: There will be a pregnancy exposure registry for women who have taken Zepbound during pregnancy. The purpose of this registry is to collect information about the health of you and your baby. Talk to your healthcare provider about how you can
take part in this registry, or you may contact Lilly at 1-800-LillyRx (1-800-545-5979).
How to take
- Read the Instructions for Use that come with Zepbound.
- Use Zepbound exactly as your healthcare provider says.
- Use Zepbound with a reduced-calorie diet and increased physical activity.
- Inject Zepbound under the skin (subcutaneously) of your stomach (abdomen), thigh, or have another person inject in the back of the upper arm. Do not inject ZEPBOUND into a muscle (intramuscularly) or vein (intravenously).
- Use Zepbound 1 time each week, at any time of the day.
- Change (rotate) your injection site with each weekly injection. Do not use the same site for each injection.
If you take too much Zepbound, call your healthcare provider, call the Poison Help line at 1-800-222-1222 or go to the nearest hospital emergency room right away.
Zepbound is approved as a 2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, and 15 mg injection.
Learn more
Zepbound is a prescription medicine. For more information, call 1-800-LillyRx (1-800-545-5979) or go to www.zepbound.lilly.com.
This summary provides basic information about Zepbound but does not include all information known about this medicine. Read the information that comes with your prescription each time your prescription is filled. This information does not take the place of talking with your healthcare provider. Be sure to talk to your healthcare provider about Zepbound and how to take it. Your healthcare provider is the best person to help you decide if Zepbound is right for you.
ZP CON BS 25FEB2026
Zepbound®, its delivery device base, and KwikPen® are registered trademarks owned or licensed by Eli Lilly and Company, its subsidiaries, or affiliates.
Voice over generated by Al.
Lilly
A Medicine Company
11:07–11:09
[Lilly A Medicine Company logo appears.]
CAPTION:
Lilly
A Medicine Company
Heather Check-In
Kym Whitley’s
Zepbound®
(tirzepatide)
journey
